alphafold3

GitHub

AlphaFold 3 inference pipeline.

7,963 stars Python Markdown CodeWiki
AI Prompts & Endpoints
CodeWiki Knowledge Base

Community Tools

Community Tools

JAAG: a JSON input file Assembler for AlphaFold 3 (with Glycan Integration)

JAAG is a lightweight, web-based GUI tool that helps generate AlphaFold 3 input
JSON files with integrated glycan support. It automates the creation of correct
glycan syntax (including bondedAtomPairs + CCD), reducing manual errors when
preparing glycoprotein or glycan–protein complexes.

* Web app: https://biofgreat.org/JAAG
* Source code: https://github.com/chinchc/JAAG
* Paper: https://doi.org/10.1093/glycob/cwaf083

Note: JAAG is compatible with standalone AlphaFold 3, but not with the AlphaFold
3 server.

Modeling glycans with AlphaFold 3: capabilities, caveats, and limitations

Paper on modeling glycans (and other ligands) with AF3 that modeled and assessed
major glycan classes and provides:

* Step-by-step tutorial for building ligand inputs (applicable beyond glycans)
* Ready-to-run scripts for each glycan class
* Comprehensive CCD table for all SNFG monosaccharides
* Discussion of caveats and limitations of AF3
* Full AF3 inputs/outputs archived on ModelArchive for reproducibility

Useful resource if your AF3 ligand models appear stereochemically off.

* Paper: https://doi.org/10.1093/glycob/cwaf048
* ModelArchive: https://doi.org/10.5452/ma-af3glycan

---

Input

AlphaFold 3 Input

Specifying Input Files

You can provide inputs to run_alphafold.py in one of two ways:

- Single input file: Use the --json_path flag followed by the path to a
single JSON file. This path can be either a local path or a Google Cloud
Storage path (starting with gs://), if enabled.
- Multiple input files: Use the --input_dir flag followed by the path to a
directory of JSON files. This path can be either a local directory path or a
GCS path, if enabled.
- Within an input file, fields with names ending in Path (e.g.
pairedMsaPath) can be provided as Google Cloud Storage paths, if enabled.

Note: Google Cloud Storage paths

Google Cloud Storage (gs://) paths are supported for certain flags and fields
if the optional gcsfs dependency is installed. See the
installation instructions
for details and a complete list of supported paths.

Input Format

AlphaFold 3 uses a custom JSON input format differing from the
AlphaFold Server JSON input format.
See below for more information.

The custom AlphaFold 3 format allows:

* Specifying protein, RNA, and DNA chains, including modified residues.
* Specifying custom multiple sequence alignment (MSA) for protein and RNA
chains.
* Specifying custom structural templates for protein chains.
* Specifying ligands using
Chemical Component Dictionary (CCD) codes.
* Specifying ligands using SMILES.
* Specifying ligands by defining them using the CCD mmCIF format and supplying
them via the user-provided CCD.
* Specifying covalent bonds between entities.
* Specifying multiple random seeds.

Multiple examples of input JSON files are provided in
https://github.com/google-deepmind/alphafold3/tree/main/examples.

AlphaFold Server JSON Compatibility

The AlphaFold Server uses a separate
JSON format
from the one used here in the AlphaFold 3 codebase. In particular, the JSON
format used in the AlphaFold 3 codebase offers more flexibility and control in
defining custom ligands, branched glycans, and covalent bonds between entities.

We provide a converter in run_alphafold.py which automatically detects the
input JSON format, denoted dialect in the converter code. The converter
denotes the AlphaFoldServer JSON as alphafoldserver, and the JSON format
defined here in the AlphaFold 3 codebase as alphafold3. If the detected input
JSON format is alphafoldserver, then the converter will translate that into
the JSON format alphafold3.

Multiple Inputs

The top-level of the alphafoldserver JSON format is a list, allowing
specification of multiple inputs in a single JSON. In contrast, the alphafold3
JSON format requires exactly one input per JSON file. Specifying multiple inputs
in a single alphafoldserver JSON is fully supported.

Note that the converter distinguishes between alphafoldserver and alphafold3
JSON formats by checking if the top-level of the JSON is a list or not. In
particular, if you pass in a alphafoldserver-style JSON without a top-level
list, then this is considered incorrect and run_alphafold.py will raise an
error.

Glycans

If the JSON in alphafoldserver format specifies glycans, the converter will
raise an error. This is because translating glycans specified in the
alphafoldserver format to the alphafold3 format is not currently supported.

Random Seeds

The alphafoldserver JSON format allows users to specify "modelSeeds": [], in
which case a seed is chosen randomly for the user. On the other hand, the
alphafold3 format requires users to specify a seed.

The converter will choose a seed randomly if "modelSeeds": [] is set when
translating from alphafoldserver JSON format to alphafold3 JSON format. If
seeds are specified in the alphafoldserver JSON format, then those will be
preserved in the translation to the alphafold3 JSON format.

Ions

While AlphaFold Server treats ions and ligands as different entity types in the
JSON format, AlphaFold 3 treats ions as ligands. Therefore, to specify e.g. a
magnesium ion, one would specify it as an entity of type ligand with
ccdCodes: ["MG"].

Sequence IDs

The alphafold3 JSON format requires the user to specify a unique identifier
(id) for each entity. On the other hand, the alphafoldserver does not allow
specification of an id for each entity. Thus, the converter automatically
assigns one.

The converter iterates through the list provided in the sequences field of the
alphafoldserver JSON format, assigning an id to each entity using the
following order ("reverse spreadsheet style"):

text
A, B, ..., Z, AA, BA, CA, ..., ZA, AB, BB, CB, ..., ZB, ...

For any entity with count > 1, an id is assigned arbitrarily to each "copy"
of the entity.

Top-level Structure

The top-level structure of the input JSON is:

json
{
"name": "Job name goes here",
"modelSeeds": [1, 2], # At least one seed required.
"sequences": [
{"protein": {...}},
{"rna": {...}},
{"dna": {...}},
{"ligand": {...}}
],
"bondedAtomPairs": [...], # Optional.
"userCCD": "...", # Optional, mutually exclusive with userCCDPath.
"userCCDPath": "...", # Optional, mutually exclusive with userCCD.
"dialect": "alphafold3", # Required.
"version": 4 # Required.
}

The fields specify the following:

* name: str: The name of the job. A sanitised version of this name is used
for naming the output files.
* modelSeeds: list[int]: A list of integer random seeds. The pipeline and
the model will be invoked with each of the seeds in the list. I.e. if you
provide n random seeds, you will get n predicted structures, each with
the respective random seed. You must provide at least one random seed.
* sequences: list[Protein | RNA | DNA | Ligand]: A list of sequence
dictionaries, each defining a molecular entity, see below.
* bondedAtomPairs: list[Bond]: An optional list of covalently bonded atoms.
These can link atoms within an entity, or across two entities. See more
below.
* userCCD: str: An optional string with user-provided chemical components
dictionary. This is an expert mode for providing custom molecules when
SMILES is not sufficient. This should also be used when you have a custom
molecule that needs to be bonded with other entities - SMILES can't be used
in such cases since it doesn't give the possibility of uniquely naming all
atoms. It can also be used to provide a reference conformer for cases where
RDKit fails to generate a conformer. See more below.
* userCCDPath: str: An optional path to a file that contains the
user-provided chemical components dictionary instead of providing it inline
using the userCCD field. The path can be either absolute, or relative to
the input JSON path. The file must be in the
CCD mmCIF format, and could be
either plain text, or compressed using gzip, xz, or zstd.
* dialect: str: The dialect of the input JSON. This must be set to
alphafold3. See
AlphaFold Server JSON Compatibility
for more information.
* version: int: The version of the input JSON. This must be set to 1 or 2.
See
AlphaFold Server JSON Compatibility
and versions below for more information.

Versions

The top-level version field (for the alphafold3 dialect) can be either 1,
2, or 3. The following features have been added in respective versions:

* 1: the initial AlphaFold 3 input format.
* 2: added the option of specifying external MSA and templates using newly
added fields unpairedMsaPath, pairedMsaPath, and mmcifPath.
* 3: added the option of specifying external user-provided CCD using newly
added field userCCDPath.
* 4: added the option of specifying textual description of protein chains,
RNA chains, DNA chains, or ligands.

Sequences

The sequences section specifies the protein chains, RNA chains, DNA chains,
and ligands. Every entity in sequences must have a unique ID. IDs don't have
to be sorted alphabetically.

Protein

Specifies a single protein chain.

json
{
"protein": {
"id": "A",
"sequence": "PVLSCGEWQL",
"modifications": [
{"ptmType": "HY3", "ptmPosition": 1},
{"ptmType": "P1L", "ptmPosition": 5}
],
"description": ..., # Optional.
"unpairedMsa": ..., # Mutually exclusive with unpairedMsaPath.
"unpairedMsaPath": ..., # Mutually exclusive with unpairedMsa.
"pairedMsa": ..., # Mutually exclusive with pairedMsaPath.
"pairedMsaPath": ..., # Mutually exclusive with pairedMsa.
"templates": [...]
}
}

The fields specify the following:

* id: str | list[str]: An uppercase letter or multiple letters specifying
the unique IDs for each copy of this protein chain. The IDs are then also
used in the output mmCIF file. Specifying a list of IDs (e.g. ["A", "B",
"C"]
) implies a homomeric chain with multiple copies.
* sequence: str: The amino-acid sequence, specified as a string that uses
the 1-letter standard amino acid codes.
* modifications: list[ProteinModification]: An optional list of
post-translational modifications. Each modification is specified using its
CCD code and 1-based residue position. In the example above, we see that the
first residue won't be a proline (P) but instead HY3.
* description: str: An optional textual description of this chain. This
field will is only used in the JSON format and serves as a comment
describing this chain.
* unpairedMsa: str: An optional multiple sequence alignment for this chain.
This is specified using the A3M format (equivalent to the FASTA format, but
also allows gaps denoted by the hyphen - character). See more details
below.
* unpairedMsaPath: str: An optional path to a file that contains the
multiple sequence alignment for this chain instead of providing it inline
using the unpairedMsa field. The path can be either absolute, or relative
to the input JSON path. The file must be in the A3M format, and could be
either plain text, or compressed using gzip, xz, or zstd.
pairedMsa: str: We recommend not* using this optional field and using the
unpairedMsa for the purposes of pairing. See more details below.
* pairedMsaPath: str: An optional path to a file that contains the multiple
sequence alignment for this chain instead of providing it inline using the
pairedMsa field. The path can be either absolute, or relative to the input
JSON path. The file must be in the A3M format, and could be either plain
text, or compressed using gzip, xz, or zstd.
* templates: list[Template]: An optional list of structural templates. See
more details below.

RNA

Specifies a single RNA chain.

json
{
"rna": {
"id": "A",
"sequence": "AGCU",
"modifications": [
{"modificationType": "2MG", "basePosition": 1},
{"modificationType": "5MC", "basePosition": 4}
],
"description": ..., # Optional.
"unpairedMsa": ..., # Mutually exclusive with unpairedMsaPath.
"unpairedMsaPath": ... # Mutually exclusive with unpairedMsa.
}
}

The fields specify the following:

* id: str | list[str]: An uppercase letter or multiple letters specifying
the unique IDs for each copy of this RNA chain. The IDs are then also used
in the output mmCIF file. Specifying a list of IDs (e.g. ["A", "B", "C"])
implies a homomeric chain with multiple copies.
* sequence: str: The RNA sequence, specified as a string using only the
letters A, C, G, U.
* modifications: list[RnaModification]: An optional list of modifications.
Each modification is specified using its CCD code and 1-based base position.
* description: str: An optional textual description of this chain. This
field will is only used in the JSON format and serves as a comment
describing this chain.
* unpairedMsa: str: An optional multiple sequence alignment for this chain.
This is specified using the A3M format. See more details below.
* unpairedMsaPath: str: An optional path to a file that contains the
multiple sequence alignment for this chain instead of providing it inline
using the unpairedMsa field. The path can be either absolute, or relative
to the input JSON path. The file must be in the A3M format, and could be
either plain text, or compressed using gzip, xz, or zstd.

DNA

Specifies a single DNA chain.

json
{
"dna": {
"id": "A",
"sequence": "GACCTCT",
"modifications": [
{"modificationType": "6OG", "basePosition": 1},
{"modificationType": "6MA", "basePosition": 2}
],
"description": ... # Optional.
}
}

The fields specify the following:

* id: str | list[str]: An uppercase letter or multiple letters specifying
the unique IDs for each copy of this DNA chain. The IDs are then also used
in the output mmCIF file. Specifying a list of IDs (e.g. ["A", "B", "C"])
implies a homomeric chain with multiple copies.
* sequence: str: The DNA sequence, specified as a string using only the
letters A, C, G, T.
* modifications: list[DnaModification]: An optional list of modifications.
Each modification is specified using its CCD code and 1-based base position.
* description: str: An optional textual description of this chain. This
field will is only used in the JSON format and serves as a comment
describing this chain.

Ligands

Specifies a single ligand. Ligands can be specified using 3 different formats:

1. CCD code(s). This is the easiest way to
specify ligands. Supports specifying covalent bonds to other entities. CCD
from 2022-09-28 is used. If multiple CCD codes are specified, you may want
to specify a bond between these and/or a bond to some other entity. See the
bonds section below.
2. SMILES string.
This enables specifying ligands that are not in CCD. If using SMILES, you
cannot specify covalent bonds to other entities as these rely on specific
atom names - see the next option for what to use for this case.
3. User-provided CCD + custom ligand codes. This enables specifying ligands not
in CCD, while also supporting specification of covalent bonds to other
entities and backup reference coordinates for when RDKit fails to generate a
conformer. This offers the most flexibility, but also requires careful
attention to get all of the details right.

json
{
"ligand": {
"id": ["G", "H", "I"],
"ccdCodes": ["ATP"],
"description": ... # Optional.
}
},
{
"ligand": {
"id": "J",
"ccdCodes": ["LIG-1337"],
"description": ... # Optional.
}
},
{
"ligand": {
"id": "K",
"smiles": "CC(=O)OC1C[NH+]2CCC1CC2",
"description": ... # Optional.
}
}

The fields specify the following:

* id: str | list[str]: An uppercase letter (or multiple letters) specifying
the unique ID of this ligand. This ID is then also used in the output mmCIF
file. Specifying a list of IDs (e.g. ["A", "B", "C"]) implies a ligand
that has multiple copies.
* ccdCodes: list[str]: An optional list of CCD codes. These could be either
standard CCD codes, or custom codes pointing to the
user-provided CCD.
* smiles: str: An optional string defining the ligand using a SMILES string.
The SMILES string must be correctly JSON-escaped.
* description: str: An optional textual description of this chain. This
field will is only used in the JSON format and serves as a comment
describing this ligand.

Each ligand may be specified using CCD codes or SMILES but not both, i.e. for a
given ligand, the ccdCodes and smiles fields are mutually exclusive.

#### SMILES string JSON escaping

The SMILES string must be correctly JSON-escaped, in particular the backslash
character must be escaped as two backslashes, otherwise the JSON parser will
fail with a JSONDecodeError. For instance, the following SMILES string
CCCC@@HCC\C=C\C=C\C#CC#C\C=C\CO has to be specified as:

json
{
"ligand": {
"id": "A",
"smiles": "CCCC@@HCC\\C=C\\C=C\\C#CC#C\\C=C\\CO"
}
}

You can JSON-escape the SMILES string using the
jq command-line tool which should be easily
installable on most Linux systems:

bash
jq -R . <<< 'CCCC@@HCC\C=C\C=C\C#CC#C\C=C\CO'  # Replace with your SMILES.

Alternatively, you can use this Python code:

python
import json

smiles = r'CCCC@@HCC\C=C\C=C\C#CC#C\C=C\CO' # Replace with your SMILES.
print(json.dumps(smiles))

#### Reference structure construction with SMILES

For some ligands and some random seeds, RDKit might fail to generate a
conformer, indicated by the Failed to construct RDKit reference structure
error message. In this case, you can either provide a reference structure for
the ligand using the user-provided CCD Format, or
try increasing the number of RDKit conformer iterations using the
--conformer_max_iterations=... flag.

Ions

Ions are treated as ligands, e.g. a magnesium ion would simply be a ligand with
ccdCodes: ["MG"].

Multiple Sequence Alignment

Protein and RNA chains allow setting a custom Multiple Sequence Alignment (MSA).
If not set, the data pipeline will automatically build MSAs for protein and RNA
entities using Jackhmmer/Nhmmer search over genetic databases as described in
the paper.

RNA Multiple Sequence Alignment

RNA unpairedMsa can be either:

1. Unset (or set explicitly to null). AlphaFold 3 will build MSA for this RNA
chain automatically. This is the recommended option.
2. Set to an empty string (""). AlphaFold 3 won't build the MSA for this RNA
chain and the MSA input to the model will be just the RNA chain (equivalent
to running MSA-free for this RNA chain).
3. Set to a non-empty A3M string. AlphaFold 3 will use the provided MSA for
this RNA chain.

Protein Multiple Sequence Alignment

For protein chains, the situation is slightly more complicated due to paired and
unpaired MSA (see MSA Pairing below for more details).

The following combinations are valid for a given protein chain:

1. Both unpairedMsa and pairedMsa fields are unset (or set explicitly to
null), AlphaFold 3 will build both MSAs automatically. This is the
recommended option.
2. The unpairedMsa is set to to a non-empty A3M string, pairedMsa set to an
empty string (""). AlphaFold 3 won't build MSA, will use the unpairedMsa
as is and run pairedMSA-free.
3. The pairedMsa is set to to a non-empty A3M string, unpairedMsa set to an
empty string (""). AlphaFold 3 won't build MSA, will use the pairedMsa
and run unpairedMSA-free. This option is not recommended, see
MSA Pairing below.
4. Both unpairedMsa and pairedMsa fields are set to an empty string ("").
AlphaFold 3 will not build the MSA and the MSA input to the model will be
just the query sequence (equivalent to running completely MSA-free).
5. Both unpairedMsa and pairedMsa fields are set to a custom non-empty A3M
string, AlphaFold 3 will use the provided MSA instead of building one as
part of the data pipeline. This is considered an expert option.

Note that both unpairedMsa and pairedMsa have to either be both set (i.e.
non-null), or both unset (i.e. both null, explicitly or implicitly).
Typically, when setting unpairedMsa, you will set the pairedMsa to an empty
string (""). For example this will run the protein chain A with the given MSA,
but without any templates (template-free):

json
{
"protein": {
"id": "A",
"sequence": ...,
"unpairedMsa": "The A3M you want to run with",
"pairedMsa": "",
"templates": []
}
}

When setting your own MSA, you have to make sure that:

1. The MSA is in the A3M format. This means adhering to the FASTA format while
also allowing lowercase characters denoting inserted residues and hyphens
(-) denoting gaps in sequences.
2. The first sequence is exactly equal to the query sequence.
3. If all insertions are removed from MSA hits (i.e. all lowercase letters are
removed), all sequences have exactly the same length as the query (they form
an exact rectangular matrix).

MSA Pairing

MSA pairing matters only when folding multiple chains (multimers), since we need
to find a way to concatenate MSAs for the individual chains along the sequence
dimension. If done naively, by simply concatenating the individual MSA matrices
along the sequence dimension and padding so that all MSAs have the same depth,
one can end up with rows in the concatenated MSA that are formed by sequences
from different organisms.

It may be desirable to ensure that across multiple chains, sequences in the MSA
that are from the same organism end up in the same MSA row. AlphaFold 3
internally achieves this by looking for the UniProt organism ID in the
pairedMsa and pairing sequences based on this information.

We recommend users do the pairing manually or use the output of an appropriate
software and then provide the MSA using only the unpairedMsa field. This
method gives exact control over the placement of each sequence in the MSA, as
opposed to relying on name-matching post-processing heuristics used for
pairedMsa.

When setting unpairedMsa manually, the pairedMsa must be explicitly set to
an empty string ("").

Make sure to run with --resolve_msa_overlaps=false. This prevents
deduplication of the unpaired MSA within each chain against the paired MSA
sequences. Even if you set pairedMsa to an empty string, the query sequence(s)
will still be added in there and the deduplication procedure could destroy the
carefully crafted sequence positioning in the unpaired MSA.

For instance, if there are two chains DEEP and MIND which we want to be
paired on organism A and C, we can achieve it as follows:

txt
query

DEEP
match 1 (organism A)

D--P
match 2 (organism B)

DD-P
match 3 (organism C)

DD-P

txt
query

MIND
match 1 (organism A)

M--D
Empty hit to make sure pairing is achieved

----
match 2 (organism C)

MIN-

The resulting MSA when chains are concatenated will then be:

txt
query

DEEPMIND
match 1 + match 1

D--PM--D
match 2 + padding

DD-P----
match 3 + match 2

DD-PMIN-

Structural Templates

Structural templates can be specified only for protein chains:

json
"templates": [
{
"mmcif": ..., # Mutually exclusive with mmcifPath.
"mmcifPath": ..., # Mutually exclusive with mmcif.
"queryIndices": [0, 1, 2, 4, 5, 6],
"templateIndices": [0, 1, 2, 3, 4, 8]
}
]

The fields specify the following:

* mmcif: str: A string containing the single chain protein structural
template in the mmCIF format.
* mmcifPath: str: An optional path to a file that contains the mmCIF with
the structural template instead of providing it inline using the mmcifPath
field. The path can be either absolute, or relative to the input JSON path.
The file must be in the mmCIF format, and could be either plain text, or
compressed using gzip, xz, or zstd.
* queryIndices: list[int]: O-based indices in the query sequence, defining
the mapping from query residues to template residues.
* templateIndices: list[int]: O-based indices in the template sequence,
specifying the mapping from query residues to template residues defined in
the mmCIF file. Note that unresolved mmCIF residues must be taken into
account when specifying template indices.

A template is specified as an mmCIF string containing a single chain with the
structural template together with a 0-based mapping that maps query residue
indices to the template residue indices. The mapping is specified using two
lists of the same length. E.g. to express a mapping {0: 0, 1: 2, 2: 5, 3: 6},
you would specify the two indices lists as:

json
"queryIndices":    [0, 1, 2, 3],
"templateIndices": [0, 2, 5, 6]

Note that mmCIFs can have residues with missing atom coordinates (present in
residue tables but missing in the _atom_site table) – these must be taken into
account when specifying template indices. E.g. to align residues 4–7 in a
template with unresolved residues 1, 2, 3 and resolved residues 4, 5, 6, 7, you
need to set the template indices to 3, 4, 5, 6 (since 0-based indexing is used).
An example of a protein with unresolved residues 1–20 can be found here:
https://www.rcsb.org/structure/8UXY.

You can provide multiple structural templates. Note that if an mmCIF containing
more than one chain is provided, you will get an error since it is not possible
to determine which of the chains should be used as the template.

You can run template-free (but still run genetic search and build MSA) by
setting templates to [] and either explicitly setting both unpairedMsa and
pairedMsa to null:

json
"protein": {
"id": "A",
"sequence": ...,
"pairedMsa": null,
"unpairedMsa": null,
"templates": []
}

Or you can simply fully omit them:

json
"protein": {
"id": "A",
"sequence": ...,
"templates": []
}

You can also run with pre-computed MSA, but let AlphaFold 3 search for
templates. This can be achieved by setting unpairedMsa and pairedMsa, but
keeping templates unset (or set to null). The profile given as an input to
Hmmsearch when searching for templates will be built from the provided
unpairedMsa:

json
"protein": {
"id": "A",
"sequence": ...,
"unpairedMsa": ...,
"pairedMsa": ...,
"templates": null
}

Or you can simply fully omit the templates field thus setting it implicitly to
null:

json
"protein": {
"id": "A",
"sequence": ...,
"unpairedMsa": ...,
"pairedMsa": ...,
}

Bonds

To manually specify covalent bonds, use the bondedAtomPairs field. This is
intended for modelling covalent ligands, and for defining multi-CCD ligands
(e.g. glycans). Defining covalent bonds between or within polymer entities is
not currently supported.

Bonds are specified as pairs of (source atom, destination atom), with each atom
being uniquely addressed using 3 fields:

* Entity ID (str): this corresponds to the id field for that entity.
Residue ID (int): this is 1-based residue index within* the chain.
For single-residue ligands, this is simply set to 1.
Atom name (str): this is the unique atom name within* the given
residue. The atom name for protein/RNA/DNA residues or CCD ligands can be
looked up in the CCD for the given chemical component. This also explains
why SMILES ligands don't support bonds: there is no atom name that could be
used to define the bond. This shortcoming can be addressed by using the
user-provided CCD format (see below).

The example below shows two bonds:

json
"bondedAtomPairs": [
[["A", 145, "SG"], ["L", 1, "C04"]],
[["J", 1, "O6"], ["J", 2, "C1"]]
]

The first bond is between chain A, residue 145, atom SG and chain L, residue 1,
atom C04. This is a typical example for a covalent ligand. The second bond is
between chain J, residue 1, atom O6 and chain J, residue 2, atom C1. This bond
is within the same entity and is a typical example when defining a glycan.

All bonds are implicitly assumed to be covalent bonds. Other bond types are not
supported.

Defining Glycans

Glycans are bound to a protein residue, and they are typically formed of
multiple chemical components. To define a glycan, define a new ligand with all
of the chemical components of the glycan. Then define a bond that links the
glycan to the protein residue, and all bonds that are within the glycan between
its individual chemical components.

For example, to define the following glycan composed of 4 components (CMP1,
CMP2, CMP3, CMP4) bound to an asparagine in a protein chain A:

text

ALA CMP4
| |
ASN ―― CMP1 ―― CMP2
| |
ALA CMP3

You will need to specify:

1. Protein chain A.
2. Ligand chain B with the 4 components.
3. Bonds ASN-CMP1, CMP1-CMP2, CMP2-CMP3, CMP2-CMP4.

User-provided CCD

There are two approaches to model a custom ligand not defined in the CCD:

1. If the ligand is not bonded to other entities, it can be defined using a
SMILES string.
2. If it is bonded to other entities, or to be able to customise relevant
features (such as bond orders, atom names and ideal coordinates used when
conformer generation fails), it is necessary to define that particular
ligand using the
CCD mmCIF format.

Note that if a full CCD mmCIF is provided, any SMILES string input as part of
that mmCIF is ignored.

Once defined, this ligand needs to be assigned a name that doesn't clash with
existing CCD ligand names (e.g. LIG-1). Avoid underscores (_) in the name,
as it could cause issues in the mmCIF format.

The newly defined ligand can then be used as a standard CCD ligand using its
custom name, and bonds can be linked to it using its named atom scheme.

Using user-provided CCD for polymer modifications

The user-provided CCD can also be used for specifying non-canonical amino acids
or nucleotides in the protein/RNA/DNA chains, not only custom ligands.

In this case, the custom component is referenced from the polymer
modifications field using its CCD component ID:

json
{
"protein": {
"id": "A",
"sequence": "MDQHQAFKEATELLEKMKTSSDEERVEYLRKAVRLFNLTSEGQQGELVGKFKEAGVLIRAVDLS",
"modifications": [{"ptmType": "MYMOD", "ptmPosition": 30}]
}
}

In the example above, residue 30 is replaced by the custom component MYMOD.

* ptmType must match the component ID defined in the user-provided CCD.
* The user-provided CCD should describe an appropriate peptide-linking polymer
component rather than a free non-polymer ligand.
* The user-provided CCD entry should include the expected backbone atoms and
bond graph for the residue, adjusted for the residue position in the polymer
chain. E.g. atoms and bond graphs for the mid-chain residue and terminal
residue may differ.

The same principle applies to RNA and DNA chains. This workflow is useful for
modeling non-canonical amino acids or nucleotides in the context of polymer
chains. By contrast, external covalent ligands should generally be modeled as
ligand entities plus bondedAtomPairs.

Conformer Generation

The data pipeline attempts to generate a conformer for ligands using RDKit. The
Mol used to generate the conformer is constructed either from the information
provided in the CCD mmCIF, or from the SMILES string if that is the only
information provided.

If conformer generation fails, the model will fall back to using the ideal
coordinates in the CCD mmCIF if these are provided. If they are not provided,
the model will use the reference coordinates if the last modification date given
in the CCD mmCIF is prior to the training cutoff date. If no coordinates can be
found in this way, all conformer coordinates are set to zero and the model will
output NaN (null in the output JSON) confidences for the ligand.

Note that sometimes conformer generation failures can be resolved by
increasinging the number of RDKit conformer iterations using the
--conformer_max_iterations=... flag.

User-provided CCD Format

The user-provided CCD must be passed either:

* In the userCCD field (in the root of the input JSON) as a string. Note
that JSON doesn't allow newlines within strings, so newline characters
(\n) must be used to delimit lines. Single rather than double quotes
should also be used around strings like the chemical formula.
* In the userCCDPath field, as a path to a file that contains the
user-provided chemical components dictionary. The path can be either
absolute, or relative to the input JSON path. The file must be in the
CCD mmCIF format, and could be
either plain text, or compressed using gzip, xz, or zstd.

The main pieces of information used are the atom names and elements, bonds, and
also the ideal coordinates (pdbx_model_Cartn_{x,y,z}_ideal) which essentially
serve as a structural template for the ligand if RDKit fails to generate
conformers for that ligand.

The user-provided CCD can also be used to redefine standard chemical components
in the CCD. This can be useful if you need to redefine the ideal coordinates.

Below is an example user-provided CCD redefining component X7F, which serves to
illustrate the required sections. For readability purposes, newlines have not
been replaced by \n.

text
/ Detailed source-code truncated for AI context efficiency. /

Mandatory fields

Parsing the user-provided CCD needs only a subset of the fields that CCD uses.
The mandatory fields are described below. Refer to
CCD documentation for more
detailed explanation of each field. Note that not all of these fields are input
to the model, but they are necessary for the data pipeline to run – see the
Model input fields section below.

Singular fields (containing just a single value)

* _chem_comp.id: The ID of the component. Must match the _data record and
must not contain special CIF characters (like _ or #).
* _chem_comp.name: Optional full name of the component. If unknown, set to
?.
* _chem_comp.type: Type of the component, typically non-polymer.
* _chem_comp.formula: Optional component formula. If unknown, set to ?.
* _chem_comp.mon_nstd_parent_comp_id: Optional parent component ID. If
unknown, set to ?.
* _chem_comp.pdbx_synonyms: Optional synonym IDs. If unknown, set to ?.
* _chem_comp.formula_weight: Optional weight of the component. If unknown,
set to ?.

Per-atom fields (containing one record per atom)

* _chem_comp_atom.comp_id: Component ID.
* _chem_comp_atom.atom_id: Atom ID.
* _chem_comp_atom.type_symbol: Atom element type.
* _chem_comp_atom.charge: Atom charge.
* _chem_comp_atom.pdbx_leaving_atom_flag: Optional flag determining whether
this is a leaving atom. If unset, assumed to be no (N) for all atoms.
* _chem_comp_atom.pdbx_model_Cartn_x_ideal: Ideal x coordinate.
* _chem_comp_atom.pdbx_model_Cartn_y_ideal: Ideal y coordinate.
* _chem_comp_atom.pdbx_model_Cartn_z_ideal: Ideal z coordinate.

Per-bond fields (containing one record per bond)

* _chem_comp_bond.atom_id_1: The ID of the first of the two atoms that
define the bond.
* _chem_comp_bond.atom_id_2: The ID of the second of the two atoms that
define the bond.
* _chem_comp_bond.value_order: The bond order of the chemical bond
associated with the specified atoms.
* _chem_comp_bond.pdbx_aromatic_flag: Whether the bond is aromatic.

Model input fields

The following fields are used to generate input for the model:

* _chem_comp_atom.atom_id: Atom ID.
* _chem_comp_atom.type_symbol: Atom element type.
* _chem_comp_atom.charge: Atom charge.
* _chem_comp_atom.pdbx_model_Cartn_x_ideal: Ideal x coordinate. Only used if
conformer generation fails.
* _chem_comp_atom.pdbx_model_Cartn_y_ideal: Ideal y coordinate. Only used if
conformer generation fails.
* _chem_comp_atom.pdbx_model_Cartn_z_ideal: Ideal z coordinate. Only used if
conformer generation fails.
* _chem_comp_bond.atom_id_1: The ID of the first of the two atoms that
define the bond.
* _chem_comp_bond.atom_id_2: The ID of the second of the two atoms that
define the bond.

Full Example

An example illustrating all the aspects of the input format is provided below.
Note that AlphaFold 3 won't run this input out of the box as it abbreviates
certain fields and the sequences are not biologically meaningful.

text
/ Detailed source-code truncated for AI context efficiency. /

---

Installation

Installation and Running Your First Prediction

You will need a machine running Linux; AlphaFold 3 does not support other
operating systems. Full installation requires up to 1 TB of disk space to keep
genetic databases (SSD storage is recommended) and an NVIDIA GPU with Compute
Capability 8.0 or greater (GPUs with more memory can predict larger protein
structures). We have verified that inputs with up to 5,120 tokens can fit on a
single NVIDIA A100 80 GB, or a single NVIDIA H100 80 GB. We have verified
numerical accuracy on both NVIDIA A100 and H100 GPUs.

Especially for long targets, the genetic search stage can consume a lot of RAM –
we recommend running with at least 64 GB of RAM.

We provide installation instructions for a machine with an NVIDIA A100 80 GB GPU
and a clean Ubuntu 22.04 LTS installation, and expect that these instructions
should aid others with different setups. If you are installing locally outside
of a Docker container, please ensure CUDA, cuDNN, and JAX are correctly
installed; the
JAX installation documentation
is a useful reference for this case. Note that the Docker container requires
that the host machine has CUDA 12.6 installed.

The instructions provided below describe how to:

1. Provision a machine on GCP.
1. Install Docker.
1. Install NVIDIA drivers for an A100.
1. Obtain genetic databases.
1. Obtain model parameters.
1. Build the AlphaFold 3 Docker container or Singularity image.

Provisioning a Machine

Clean Ubuntu images are available on Google Cloud, AWS, Azure, and other major
platforms.

Using an existing Google Cloud project, we provisioned a new machine:

* We recommend using --machine-type a2-ultragpu-1g but feel free to use
--machine-type a2-highgpu-1g for smaller predictions.
* If desired, replace --zone us-central1-a with a zone that has quota for
the machine you have selected. See
gpu-regions-zones.

sh
gcloud compute instances create alphafold3 \
--machine-type a2-ultragpu-1g \
--zone us-central1-a \
--image-family ubuntu-2204-lts \
--image-project ubuntu-os-cloud \
--maintenance-policy TERMINATE \
--boot-disk-size 1000 \
--boot-disk-type pd-balanced

This provisions a bare Ubuntu 22.04 LTS image on an
A2 Ultra
machine with 12 CPUs, 170 GB RAM, 1 TB disk and NVIDIA A100 80 GB GPU attached.
We verified the following installation steps from this point.

Installing Docker

These instructions are for rootless Docker.

Installing Docker on Host

Note these instructions only apply to Ubuntu 22.04 LTS images, see above.

Add Docker's official GPG key. Official Docker instructions are
here.
The commands we ran are:

sh
sudo apt-get update
sudo apt-get install ca-certificates curl
sudo install -m 0755 -d /etc/apt/keyrings
sudo curl -fsSL https://download.docker.com/linux/ubuntu/gpg -o /etc/apt/keyrings/docker.asc
sudo chmod a+r /etc/apt/keyrings/docker.asc

Add the repository to apt sources:

sh
echo \
"deb [arch=$(dpkg --print-architecture) signed-by=/etc/apt/keyrings/docker.asc] https://download.docker.com/linux/ubuntu \
$(. /etc/os-release && echo "$VERSION_CODENAME") stable" | \
sudo tee /etc/apt/sources.list.d/docker.list > /dev/null
sudo apt-get update
sudo apt-get install -y docker-ce docker-ce-cli containerd.io docker-buildx-plugin docker-compose-plugin
sudo docker run hello-world

Enabling Rootless Docker

Official Docker instructions are
here.
The commands we ran are:

sh
sudo apt-get install -y uidmap systemd-container

sudo machinectl shell $(whoami)@ /bin/bash -c 'dockerd-rootless-setuptool.sh install && sudo loginctl enable-linger $(whoami) && DOCKER_HOST=unix:///run/user/1001/docker.sock docker context use rootless'

Installing GPU Support

Installing NVIDIA Drivers

Official Ubuntu instructions are
here.
The commands we ran are:

sh
sudo apt-get -y install alsa-utils ubuntu-drivers-common
sudo ubuntu-drivers install

sudo nvidia-smi --gpu-reset

nvidia-smi # Check that the drivers are installed.

Accept the "Pending kernel upgrade" dialog if it appears.

You will need to reboot the instance with sudo reboot now to reset the GPU if
you see the following warning:

text
NVIDIA-SMI has failed because it couldn't communicate with the NVIDIA driver.
Make sure that the latest NVIDIA driver is installed and running.

Proceed only if nvidia-smi has a sensible output.

Installing NVIDIA Support for Docker

Official NVIDIA instructions are
here.
The commands we ran are:

sh
curl -fsSL https://nvidia.github.io/libnvidia-container/gpgkey | sudo gpg --dearmor -o /usr/share/keyrings/nvidia-container-toolkit-keyring.gpg \
&& curl -s -L https://nvidia.github.io/libnvidia-container/stable/deb/nvidia-container-toolkit.list | \
sed 's#deb https://#deb [signed-by=/usr/share/keyrings/nvidia-container-toolkit-keyring.gpg] https://#g' | \
sudo tee /etc/apt/sources.list.d/nvidia-container-toolkit.list
sudo apt-get update
sudo apt-get install -y nvidia-container-toolkit
nvidia-ctk runtime configure --runtime=docker --config=$HOME/.config/docker/daemon.json
systemctl --user restart docker
sudo nvidia-ctk config --set nvidia-container-cli.no-cgroups --in-place

Check that your container can see the GPU:

sh
docker run --rm --gpus all nvidia/cuda:12.6.0-base-ubuntu22.04 nvidia-smi

Example output:

text
/ Detailed source-code truncated for AI context efficiency. /

Obtaining AlphaFold 3 Source Code

Install git and download the AlphaFold 3 repository:

sh
git clone https://github.com/google-deepmind/alphafold3.git

Obtaining Genetic Databases

This step requires wget and zstd to be installed on your machine. On
Debian-based systems install them by running sudo apt install wget zstd.

AlphaFold 3 needs multiple genetic (sequence) protein and RNA databases to run:

* BFD small
* MGnify
* PDB (structures in the mmCIF format)
* PDB seqres
* UniProt
* UniRef90
* NT
* RFam
* RNACentral

We provide a bash script fetch_databases.sh that can be used to download and
set up all of these databases. This process takes around 45 minutes when not
installing on local SSD. We recommend running the following in a screen or
tmux session as downloading and decompressing the databases takes some time.

sh
cd alphafold3  # Navigate to the directory with cloned AlphaFold 3 repository.
./fetch_databases.sh [<DB_DIR>]

This script downloads the databases from a mirror hosted on GCS, with all
versions being the same as used in the AlphaFold 3 paper, to the directory
<DB_DIR>. If not specified, the default <DB_DIR> is
$HOME/public_databases.

:ledger: Note: The download directory <DB_DIR> should not be a
subdirectory in the AlphaFold 3 repository directory. If it is, the Docker
build will be slow as the large databases will be copied during the image
creation.

:ledger: Note: The total download size for the full databases is around 252 GB
and the total size when unzipped is 630 GB. Please make sure you have sufficient
hard drive space, bandwidth, and time to download. We recommend using an SSD for
better genetic search performance.

:ledger: Note: If the download directory and datasets don't have full read and
write permissions, it can cause errors with the MSA tools, with opaque
(external) error messages. Please ensure the required permissions are applied,
e.g. with the sudo chmod 755 --recursive <DB_DIR> command.

Once the script has finished, you should have the following directory structure:

sh
mmcif_files/  # Directory containing ~200k PDB mmCIF files.
bfd-first_non_consensus_sequences.fasta
mgy_clusters_2022_05.fa
nt_rna_2023_02_23_clust_seq_id_90_cov_80_rep_seq.fasta
pdb_seqres_2022_09_28.fasta
rfam_14_9_clust_seq_id_90_cov_80_rep_seq.fasta
rnacentral_active_seq_id_90_cov_80_linclust.fasta
uniprot_all_2021_04.fa
uniref90_2022_05.fa

Optionally, after the script finishes, you may want copy databases to an SSD.
You can use theses two scripts:

* src/scripts/gcp_mount_ssd.sh [<SSD_MOUNT_PATH>] Mounts and formats an
unmounted GCP SSD drive to the specified path. It will skip the either step
if the disk is either already formatted or already mounted. The default
<SSD_MOUNT_PATH> is /mnt/disks/ssd.
* src/scripts/copy_to_ssd.sh [<DB_DIR>] [<SSD_DB_DIR>] this will copy as
many files that it can fit on to the SSD. The default <DB_DIR> is
$HOME/public_databases, and must match the path used in the
fetch_databases.sh command above, and the default <SSD_DB_DIR> is
/mnt/disks/ssd/public_databases.

Obtaining Model Parameters

You can download the AlphaFold 3 model parameters from
https://storage.googleapis.com/alphafold3/af3.bin.zst. Use is subject to these
terms of use.

Download the model parameters to a directory of your choosing, referred to as
<MODEL_PARAMETERS_DIR> in the following instructions. As with the databases,
this should not be a subdirectory in the AlphaFold 3 repository directory.

Building the Docker Container That Will Run AlphaFold 3

Then, build the Docker container. This builds a container with all the right
python dependencies:

sh
docker build -t alphafold3 -f docker/Dockerfile .

If you hit No file descriptors available (os error 24) on systems like
AlmaLinux/Rocky/RHEL, you need to manually expand the file descriptor limits
during the build by appending --ulimit nofile=65535:65535:

sh
docker build --ulimit nofile=65535:65535 -t alphafold3 -f docker/Dockerfile .

Create an input JSON file, using either the example in the
README
or a
custom input,
and place it in a directory, e.g. $HOME/af_input. You can now run AlphaFold 3!

sh
docker run -it \
--volume $HOME/af_input:/root/af_input \
--volume $HOME/af_output:/root/af_output \
--volume <MODEL_PARAMETERS_DIR>:/root/models \
--volume <DB_DIR>:/root/public_databases \
--gpus all \
alphafold3 \
python run_alphafold.py \
--json_path=/root/af_input/fold_input.json \
--model_dir=/root/models \
--output_dir=/root/af_output

where $HOME/af_input is the directory containing the input JSON file;
$HOME/af_output is the directory where the output will be written to; and
<DB_DIR> and <MODEL_PARAMETERS_DIR> are the directories containing the
databases and model parameters. The values of these directories must match the
directories used in previous steps for downloading databases and model weights,
and for the input file.

:ledger: Note: You may also need to create the output directory,
$HOME/af_output directory before running the docker command and make it and
the input directory writable from the docker container, e.g. by running chmod
755 $HOME/af_input $HOME/af_output
. In most cases docker and
run_alphafold.py will create the output directory if it does not exist.

:ledger: Note: In the example above the databases have been placed on the
persistent disk, which is slow. If you want better genetic and template search
performance, make sure all databases are placed on a local SSD.

If you have some databases on an SSD in the <SSD_DB_DIR> directory and some
databases on a slower disk in the <DB_DIR> directory, you can mount both
directories and specify db_dir multiple times. This will enable the fast
access to databases with a fallback to the larger, slower disk:

sh
docker run -it \
--volume $HOME/af_input:/root/af_input \
--volume $HOME/af_output:/root/af_output \
--volume <MODEL_PARAMETERS_DIR>:/root/models \
--volume <SSD_DB_DIR>:/root/public_databases \
--volume <DB_DIR>:/root/public_databases_fallback \
--gpus all \
alphafold3 \
python run_alphafold.py \
--json_path=/root/af_input/fold_input.json \
--model_dir=/root/models \
--db_dir=/root/public_databases \
--db_dir=/root/public_databases_fallback \
--output_dir=/root/af_output

If you get an error like the following, make sure the models and data are in the
paths (flags named --volume above) in the correct locations.

text
docker: Error response from daemon: error while creating mount source path '/srv/alphafold3_data/models': mkdir /srv/alphafold3_data/models: permission denied.

run_alphafold.py supports many flags for controlling performance, running on
multiple input files, specifying external binary paths, and more. See

sh
docker run alphafold3 python run_alphafold.py --help

for more information.

:ledger: Optional: Enable Google cloud storage path support

AlphaFold 3 supports reading and writing specific files directly from Google
Cloud Storage (gs:// paths). Since GCS is an optional feature, the required
gcsfs dependency is not installed by default. To enable GCS support when
building the Docker container, pass the UV_EXTRAS build argument when running
docker build:

sh
docker build --build-arg UV_EXTRAS="--extra gcsfs" -t alphafold3 -f docker/Dockerfile .

The following command-line flags support gs:// paths:

- --input_dir
- --json_path
- --output_dir
- --model_dir
- --pdb_database_path
- In the JSON input file, fields with names ending in Path (e.g.
pairedMsaPath) can be provided as Google Cloud Storage paths, if enabled.

:warning: All other database paths (e.g., --db_dir,
--small_bfd_database_path, etc.) and binary paths (e.g.,
--jackhmmer_binary_path) do not support gs:// paths and must be local
file paths.

Running Using Singularity Instead of Docker

You may prefer to run AlphaFold 3 within Singularity. You'll still need to
build the Singularity image from the Docker container. Afterwards, you will
not have to depend on Docker (at structure prediction time).

Install Singularity

Official Singularity instructions are
here. The
commands we ran are:

sh
wget https://github.com/sylabs/singularity/releases/download/v4.2.1/singularity-ce_4.2.1-jammy_amd64.deb
sudo dpkg --install singularity-ce_4.2.1-jammy_amd64.deb
sudo apt-get install -f

Build the Singularity Container From the Docker Image

After building the Docker container above with docker build -t, start a
local Docker registry and upload your image alphafold3 to it. Singularity's
instructions are here.
The commands we ran are:

sh
docker run -d -p 5000:5000 --restart=always --name registry registry:2
docker tag alphafold3 localhost:5000/alphafold3
docker push localhost:5000/alphafold3

Then build the Singularity container:

sh
SINGULARITY_NOHTTPS=1 singularity build alphafold3.sif docker://localhost:5000/alphafold3:latest

You can confirm your build by starting a shell and inspecting the environment.
For example, you may want to ensure the Singularity image can access your GPU.
You may want to restart your computer if you have issues with this.

sh
singularity exec --nv alphafold3.sif sh -c 'nvidia-smi'

You can now run AlphaFold 3!

sh
singularity exec --nv alphafold3.sif <<args>>

For example:

sh
singularity exec \
--nv \
--bind $HOME/af_input:/root/af_input \
--bind $HOME/af_output:/root/af_output \
--bind <MODEL_PARAMETERS_DIR>:/root/models \
--bind <DB_DIR>:/root/public_databases \
alphafold3.sif \
python run_alphafold.py \
--json_path=/root/af_input/fold_input.json \
--model_dir=/root/models \
--db_dir=/root/public_databases \
--output_dir=/root/af_output

Or with some databases on SSD in location <SSD_DB_DIR>:

sh
singularity exec \
--nv \
--bind $HOME/af_input:/root/af_input \
--bind $HOME/af_output:/root/af_output \
--bind <MODEL_PARAMETERS_DIR>:/root/models \
--bind <SSD_DB_DIR>:/root/public_databases \
--bind <DB_DIR>:/root/public_databases_fallback \
alphafold3.sif \
python run_alphafold.py \
--json_path=/root/af_input/fold_input.json \
--model_dir=/root/models \
--db_dir=/root/public_databases \
--db_dir=/root/public_databases_fallback \
--output_dir=/root/af_output

Running AlphaFold 3 without a GPU (CPU-only)

It is possible to run AlphaFold 3 on a computer without a GPU. Note though that
this is not an officially supported mode (we don't perform rigorous numerical
accuracy testing for this mode). This mode can be useful for utilizing machines
without a GPU if you don't mind the longer folding times (roughly 100x slower
than on a GPU).

Direct installation without Docker on Linux or Mac OS

Since JAX doesn't support running natively on Mac GPU as of 2026, you have to
resort to running AlphaFold 3 in the slow CPU-only mode even though it has a GPU
(jax-metal is unfinished as of July 2026).

1. Download all required databases and AlphaFold 3 weights (see above).
2. Install the HMMER Suite. See
http://hmmer.org/documentation.html for installation instructions.
3. Install uv. See
https://docs.astral.sh/uv/getting-started/installation/ for installation
instructions.
4. Clone the AlphaFold 3 GitHub repository

sh
git clone https://github.com/google-deepmind/alphafold3.git

5. Navigate in the alphafold3 directory and run the following commands to
install AlphaFold 3:

sh
cd alphafold3
uv venv --python 3.12
source .venv/bin/activate
uv sync
uv run build_data

6. Check the installation by running the AlphaFold 3 data test:

sh
uv run python run_alphafold_data_test.py

7. You can now run AlphaFold 3. If you are running on a Linux CPU-only machine,
make sure to set flags --jax_backend="cpu" and
--flash_attention_implementation="xla". If you are running on Mac OS with
Apple Silicon, you can set --jax_backend="mps" instead and get roughly 3x
better inference performance by using the built-in GPU:

sh
uv run run_alphafold.py \
--json_path="..." \
--output_dir="..." \
--model_dir="..." \
--jax_backend="cpu" \
--flash_attention_implementation="xla"

#### Running on Mac OS using the Apple Silicon GPU

As an alternative to CPU-only mode, AlphaFold 3 inference can run on the Apple
Silicon GPU with --jax_backend="mps" via the community supported jax-mps
Metal plugin. This is an unofficial and experimental path, but it is roughly 3×
faster than CPU (possibly more on newer M chips).

---

Known Issues

Known Issues

Numerical performance for CUDA Capability 7.x GPUs

All CUDA Capability 7.x GPUs (e.g. V100) produce obviously bad output, with lots
of clashing residues (the clashes cause a ranking score of -99 or lower), unless
the environment variable XLA_FLAGS is set to include
--xla_disable_hlo_passes=custom-kernel-fusion-rewriter.

Incorrect handling of two-letter atoms in SMILES ligands

Between commits https://github.com/google-deepmind/alphafold3/commit/f8df1c7 and
https://github.com/google-deepmind/alphafold3/commit/4e4023c, AlphaFold 3
handled incorrectly any two-letter atoms (e.g. Cl, Br) in ligands defined using
SMILES strings.

MSA discrepancy between AlphaFold 3 and AlphaFold Server

The root cause of the problem

The released AlphaFold 3 and AlphaFold Server use the same model weights and
equivalent featurisation and model code. However, the way they run genetic
search is slightly different. The released AlphaFold 3 searches each database in
one go, while AlphaFold Server has a sharded version of each database (split
into multiple smaller FASTA files) and searches all of the shards in parallel.
The results of these parallel searches are then merged together at the end.

The discrepancy is caused by a different (deeper) MSA on AlphaFold Server in
some cases. We discovered that the issue is caused by running sharded Jackhmmer
in AlphaFold Server without the --domZ flag (has to be set together with the
--Z flag and set to the same value) which means that effectively the AlphaFold
Server is running with roughly 100× more permissive --domE filter. This means
more sequences are sometimes included in the MSA.

We are keeping behaviour unchanged in both the released AlphaFold 3 and in the
AlphaFold Server, however, we are giving users with local installs an option to
replicate AlphaFold Server behaviour locally. In our large scale tests the
difference did not matter, it is only very specific inputs that get better
accuracy with the deeper MSA.

See https://github.com/google-deepmind/alphafold3/issues/492 for an example
input where a protein-DNA complex gets significantly higher ipTM and pTM with
AlphaFold Server compared to a local run.

Replicating AlphaFold Server behaviour locally

If you want to replicate AlphaFold Server behaviour (i.e. better folding
accuracy in some cases), you can increase the value of the Jackhmmer/Nhmmer
--domE flag by 100× compared to its default value.

Alternatively, you can run the sharded MSA search while not setting the --domZ
value – you would have to modify the code to do it. We added support for
searching against sharded databases in AlphaFold 3 in
https://github.com/google-deepmind/alphafold3/commit/805adc3863841d83d631ccd18136ad58ce3ecb34
and the way to run AlphaFold 3 with sharded databases is documented in
https://github.com/google-deepmind/alphafold3/blob/main/docs/performance.md#sharded-genetic-databases.
It can provide 10–30× speedup (potentially even more, depending on hardware) of
the genetic search.

In general, we recommend experimenting with MSA if you are seeing a prediction
with low predicted confidence. Typically adding more relevant sequences in the
MSA will increase AlphaFold prediction accuracy and model confidence scores.

Gated Linear Unit Tokamax NotImplementedError

When running AlphaFold 3 in certain configurations (e.g. on Mac OS with the MPS
backend), you might see errors like this:

text
NotImplementedError: Not supported on gpu.
Failed to run implementation
Traceback (most recent call last):
File "tokamax/_src/ops/gated_linear_unit/api.py", line 114, in gated_linear_unit
return fn(x, weights, activation=activation, precision=precision)
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
File "tokamax/_src/ops/op.py", line 197, in __call__
raise NotImplementedError(f"Not supported on {device.device_kind}.")
NotImplementedError: Not supported on gpu.

Tokamax will the chose another implementation and run the prediction
successfully, so these are safe to ignore.

---

Metadata Antibody Antigen

Metadata for Antibody-Antigen pairs used to create figure 5a

Figure 5a in the AlphaFold 3 paper was created using 71 antibody–antigen
complexes, containing 166 antibody–antigen interfaces spanning 65 interface
clusters. Scores were averaged within each interface cluster then across
clusters. Note that the first bioassembly is used in all cases.

We provide metadata for these complexes and the associated clusters in this CSV
file:

https://github.com/google-deepmind/alphafold3/blob/main/docs/metadata_antibody_antigen.csv

---

Model Parameters

Model Parameters

AlphaFold 3 layer names, shapes, and dtypes are documented in the table below.
This can be used for example to generate random parameters for AlphaFold 3
performance optimisation on new accelerators without having to obtain the
official parameters. It is important to not generate zero-only parameters for
performance optimisations as accelerators often have shortcuts for zero-only
arguments (e.g. 0 * tensor can be optimised to a no-op).

Producing random parameters could be done similarly to the following snippet:

py
from alphafold3.model import params
import numpy as np
import zstandard

parameters = ... # Data from the parameters schema.

with zstandard.open('random_weights.bin.zst', 'wb') as compressed:
for scope_name, shape, dtype in parameters:
if scope_name == '__meta__:__identifier__':
# The identifier can be all zeros.
arr = np.zeros(shape=shape, dtype=dtype)
else:
# Do not use all-zero params, instead sample uniformly between -1 and 1.
arr = np.random.uniform(low=-1, high=1, size=shape).astype(dtype)
scope_name = scope_name.split(':')
compressed.write(params.encode_record(*scope_name, arr))

Parameters Schema

text
/ Detailed source-code truncated for AI context efficiency. /

---

Output

AlphaFold 3 Output

Output Directory Structure

For every input job, AlphaFold 3 writes all its outputs in a directory called by
the sanitized version of the job name. E.g. for job name "My first fold (TEST)",
AlphaFold 3 will write its outputs in a directory called My_first_fold_TEST
(the case is respected). If such directory already exists, AlphaFold 3 will
append a timestamp to the directory name to avoid overwriting existing data
unless --force_output_dir is passed.

The output directory can also be a Google Cloud Storage path (gs://) if the
gcsfs dependency is installed (see the
installation instructions).

The following structure is used within the output directory:

* Sub-directories with results for each sample and seed. There will be
num\_seeds \ num\_samples* such sub-directories. The naming pattern is
seed-<seed value>_sample-<sample number>. Each of these directories
contains a confidence JSON, summary confidence JSON, and the mmCIF with the
predicted structure.
* Distogram for each seed: seed-<seed value>_distogram/distogram.npz. The
Numpy zip file contains a single key: distogram. The distogram can be
large, its shape is (num_tokens, num_tokens, 64) and dtype np.float16
(almost 3 GiB for a 5,000-token input). Only saved if AlphaFold 3 is run
with --save_distogram=true.
* Embeddings for each seed: seed-<seed value>_embeddings/embeddings.npz. The
Numpy zip file contains 2 keys: single_embeddings and pair_embeddings.
The embeddings can be large, their shapes are (num_tokens, 384) for
single_embeddings, and (num_tokens, num_tokens, 128) for
pair_embeddings. Their dtype is np.float16 (almost 6 GiB for a
5,000-token input). Only saved if AlphaFold 3 is run with
--save_embeddings=true.
* Top-ranking prediction mmCIF: <job_name>_model.cif. This file contains the
predicted coordinates and should be compatible with most structural biology
tools. We do not provide the output in the PDB format, the CIF file can be
easily converted into one if needed.
* Top-ranking prediction confidence JSON: <job_name>_confidences.json.
* Top-ranking prediction summary confidence JSON:
<job_name>_summary_confidences.json.
* Job input JSON file with the MSA and template data added by the data
pipeline: <job_name>_data.json.
* Ranking scores for all predictions: ranking_scores.csv. The prediction
with highest ranking is the one included in the root directory.
* Output terms of use: TERMS_OF_USE.md.

Below is an example AlphaFold 3 output directory listing for a job called "Hello
Fold", that has been ran with 1 seed and 5 samples:

txt
hello_fold/
├── seed-1234_distogram # Only if --save_distogram=true.
│ └── hello_fold_seed-1234_distogram.npz # Only if --save_distogram=true.
├── seed-1234_embeddings # Only if --save_embeddings=true.
│ └── hello_fold_seed-1234_embeddings.npz # Only if --save_embeddings=true.
├── seed-1234_sample-0/
│ ├── hello_fold_seed-1234_sample-0_confidences.json
│ ├── hello_fold_seed-1234_sample-0_model.cif
│ └── hello_fold_seed-1234_sample-0_summary_confidences.json
├── seed-1234_sample-1/
│ ├── hello_fold_seed-1234_sample-1_confidences.json
│ ├── hello_fold_seed-1234_sample-1_model.cif
│ └── hello_fold_seed-1234_sample-1_summary_confidences.json
├── seed-1234_sample-2/
│ ├── hello_fold_seed-1234_sample-2_confidences.json
│ ├── hello_fold_seed-1234_sample-2_model.cif
│ └── hello_fold_seed-1234_sample-2_summary_confidences.json
├── seed-1234_sample-3/
│ ├── hello_fold_seed-1234_sample-3_confidences.json
│ ├── hello_fold_seed-1234_sample-3_model.cif
│ └── hello_fold_seed-1234_sample-3_summary_confidences.json
├── seed-1234_sample-4/
│ ├── hello_fold_seed-1234_sample-4_confidences.json
│ ├── hello_fold_seed-1234_sample-4_model.cif
│ └── hello_fold_seed-1234_sample-4_summary_confidences.json
├── TERMS_OF_USE.md
├── hello_fold_confidences.json
├── hello_fold_data.json
├── hello_fold_model.cif
├── hello_fold_ranking_scores.csv
└── hello_fold_summary_confidences.json

Confidence Metrics

Similar to AlphaFold 2 and AlphaFold-Multimer, AlphaFold 3 outputs include
confidence metrics. The main metrics are:

* pLDDT: a per-atom confidence estimate on a 0-100 scale where a higher
value indicates higher confidence. pLDDT aims to predict a modified LDDT
score that only considers distances to polymers. For proteins this is
similar to the
lDDT-Cα metric but
with more granularity as it can vary per atom not just per residue. For
ligand atoms, the modified LDDT considers the errors only between the ligand
atom and polymers, not other ligand atoms. For DNA/RNA a wider radius of 30
Å is used for the modified LDDT instead of 15 Å.
* PAE (predicted aligned error): an estimate of the error in the relative
position and orientation between two tokens in the predicted structure.
Higher values indicate higher predicted error and therefore lower
confidence. For proteins and nucleic acids, PAE score is essentially the
same as AlphaFold 2, where the error is measured relative to frames
constructed from the protein backbone. For small molecules and
post-translational modifications, a frame is constructed for each atom from
its closest neighbors from a reference conformer.
* pTM and ipTM scores: the predicted template modeling (pTM) score and the
interface predicted template modeling (ipTM) score are both derived from a
measure called the template modeling (TM) score. This measures the accuracy
of the entire structure
(Zhang and Skolnick, 2004;
Xu and Zhang, 2010). A pTM
score above 0.5 means the overall predicted fold for the complex might be
similar to the true structure. ipTM measures the accuracy of the predicted
relative positions of the subunits within the complex. Values higher than
0.8 represent confident high-quality predictions, while values below 0.6
suggest a failed prediction. ipTM values between 0.6 and 0.8 are a gray zone
where predictions could be correct or incorrect. The TM score is very strict
for small structures or short chains, so pTM assigns values less than 0.05
when fewer than 20 tokens are involved; for these cases PAE or pLDDT may be
more indicative of prediction quality.

For detailed description of these confidence metrics see the
AlphaFold 3 paper. For
protein components, the
AlphaFold: A Practical guide
course for structures provides additional tutorials on the confidence metrics.

If you are interested in a specific entity or interaction, then there are
confidences available in the outputs which are specific to each chain or
chain-pair, as opposed to the full complex. See below for more details on all
the confidence metrics that are returned.

Multi-Seed and Multi-Sample Results

By default, the model samples five predictions per seed. The top-ranked
prediction across all samples and seeds is available at the top-level of the
output directory. All samples along with their associated confidences are
available in subdirectories of the output directory.

For ranking of the full complex use the ranking_score (higher is better). This
score uses overall structure confidences (pTM and ipTM), but also includes terms
that penalize clashes and encourage disordered regions not to have spurious
helices – these extra terms mean the score should only be used to rank
structures.

If you are interested in a specific entity or interaction, you may want to rank
by a metric specific to that chain or chain-pair, as opposed to the full
complex. In that case, use the per chain or per chain-pair confidence metrics
described below for ranking.

Metrics in Confidences JSON

For each predicted sample we provide two JSON files. One contains summary
metrics – summaries for either the whole structure, per chain or per chain-pair
– and the other contains full 1D or 2D arrays.

Summary outputs:

* ptm: A scalar in the range 0-1 indicating the predicted TM-score for the
full structure.
* iptm: A scalar in the range 0-1 indicating predicted interface TM-score
(confidence in the predicted interfaces) for all interfaces in the
structure.
* fraction_disordered: A scalar in the range 0-1 that indicates what
fraction of the prediction structure is disordered, as measured by
accessible surface area, see our
paper for details.
* has_clash: A boolean indicating if the structure has a significant number
of clashing atoms (more than 50% of a chain, or a chain with more than 100
clashing atoms).
* ranking_score: A scalar in the range \[-100, 1.5\] that can be used for
ranking predictions, it incorporates ptm, iptm, fraction_disordered
and has_clash into a single number with the following equation: 0.8 × ipTM
\+ 0.2 × pTM \+ 0.5 × disorder − 100 × has_clash.
* chain_pair_pae_min: A \[num_chains, num_chains\] array. Element (i, j) of
the array contains the lowest PAE value across rows restricted to chain i
and columns restricted to chain j. This has been found to correlate with
whether two chains interact or not, and in some cases can be used to
distinguish binders from non-binders.
* chain_pair_iptm: A \[num_chains, num_chains\] array. Off-diagonal element
(i, j) of the array contains the ipTM restricted to tokens from chains i and
j. Diagonal element (i, i) contains the pTM restricted to chain i. Can be
used for ranking a specific interface between two chains, when you know that
they interact, e.g. for antibody-antigen interactions
* chain_ptm: A \[num_chains\] array. Element i contains the pTM restricted
to chain i. Can be used for ranking individual chains when the structure of
that chain is most of interest, rather than the cross-chain interactions it
is involved with.
* chain_iptm: A \[num_chains\] array that gives the average confidence
(interface pTM) in the interface between each chain and all other chains.
Can be used for ranking a specific chain, when you care about where the
chain binds to the rest of the complex and you do not know which other
chains you expect it to interact with. This is often the case with ligands.
* chain_ids: A \[num_chains\] array with chain IDs in the same order as all
of the other chain-level arrays to make the JSON more self-contained.

Full array outputs:

* pae: A \[num\_tokens, num\_tokens\] array. Element (i, j) indicates the
predicted error in the position of token j, when the prediction is aligned
to the ground truth using the frame of token i.
* atom_plddts: A \[num_atoms\] array, element i indicates the predicted
local distance difference test (pLDDT) for atom i in the prediction.
* contact_probs: A \[num_tokens, num_tokens\] array. Element (i, j)
indicates the predicted probability that token i and token j are in contact
(8 Å between the representative atom for each token), see
paper for details.
* token_chain_ids: A \[num_tokens\] array indicating the chain ids
corresponding to each token in the prediction.
* atom_chain_ids: A \[num_atoms\] array indicating the chain ids
corresponding to each atom in the prediction.

Embeddings

AlphaFold 3 can be run with --save_embeddings=true to save the embeddings for
each seed. The file is in the
compressed Numpy .npz format
and can be loaded using numpy.load as a dictionary-like object with two
arrays:

* single_embeddings: A \[num\_tokens, 384\] array containing the embeddings
for each token.
*
pair_embeddings: A \[num\_tokens, num\_tokens, 128\] array containing the
pairwise embeddings between all tokens.

You can use for instance the following Python code to load the embeddings:

py
import numpy as np

with open('embeddings.npz', 'rb') as f:
embeddings = np.load(f)
single_embeddings = embeddings['single_embeddings']
pair_embeddings = embeddings['pair_embeddings']

Chirality checks

In the AlphaFold 3 paper Posebusters results, a penalty was applied to the
ranking score if the ligand of interest contained chiral errors. By running
multiple seeds and using this chiral aware ranking, chiral error rates were
greatly reduced.

We provide the method compare_chirality in
model/scoring/chirality.py
to replicate these chiral checks. Chirality is checked against CCD structures if
available, otherwise users can supply custom RDKit Mol objects for comparison.

---

Performance

Performance

Running the Pipeline in Stages

The run_alphafold.py script can be executed in stages to optimise resource
utilisation. This can be useful for:

1. Splitting the CPU-only data pipeline from model inference (which requires a
GPU), to optimise cost and resource usage.
1. Generating the JSON output file from the data pipeline only run and then
using it for multiple different inference only runs across seeds or across
variations of other features (e.g. a ligand or a partner chain).
1. Generating the JSON output for multiple individual monomer chains (e.g. for
chains A, B, C, D), then running the inference on all possible chain pairs
(AB, AC, AD, BC, BD, CD) by creating dimer JSONs by merging the monomer
JSONs. By doing this, the MSA and template search need to be run just 4
times (once for each chain), instead of 12 times.

Data Pipeline Only

Launch run_alphafold.py with --run_inference=false to generate Multiple
Sequence Alignments (MSAs) and templates, without running featurisation and
model inference. This stage can be quite costly in terms of runtime, CPU, and
RAM use. The output will be JSON files augmented with MSAs and templates that
can then be directly used as input for running inference.

Pre-computing and reusing MSA and templates

When folding multiple candidate chains with a set of fixed chains (i.e. chains
that are the same for all the runs), you can optimize the process by computing
the MSA and templates for the fixed chains only once. The computations for the
changing candidate chains will still be performed for each run:

1. Run the AlphaFold 3 data pipeline for the fixed chains using the
--run_inference=false flag. This step generates a JSON file containing the
MSA and template data for these chains.
2. When constructing your multimer input JSONs, populate the entries for the
fixed chains using the data generated in the previous step.
* For the fixed chains: Specifically, copy the
unpairedMsa, pairedMsa,
and
templates fields from the pre-computed JSON into the multimer
input JSON. This prevents these fields from being recomputed.
* For the candidate chains: Leave these fields unset (or
null) in the
multimer input JSON. This will signal the pipeline to compute them
dynamically for each run.

This technique can also be extended to efficiently process all combinations of
n first chains and m second chains. Instead of performing n × m full
computations, you can reduce this to n + m data pipeline runs.

In this scenario:

1. Run the data pipeline (step 1 above, with --run_inference=false) for all
n individual first chains and all m individual second chains.
2. Assemble the dimer input JSONs for each desired pair by combining their
respective pre-computed monomer JSONs.
3. Run only the inference step on these assembled JSONs using the
--run_data_pipeline=false flag.

This approach has been discussed in multiple GitHub issues, such as:
https://github.com/google-deepmind/alphafold3/issues/171 (which links to other
similar issues).

Featurisation and Model Inference Only

Launch run_alphafold.py with --run_data_pipeline=false to skip the data
pipeline and run only featurisation and model inference. This stage requires the
input JSON file to contain pre-computed MSAs and templates (or they must be
explicitly set to empty if you want to run MSA and template free).

Data Pipeline

The runtime of the data pipeline (i.e. genetic sequence search and template
search) can vary significantly depending on the size of the input and the number
of homologous sequences found, as well as the available hardware – the disk
speed can influence genetic search speed in particular.

If you would like to improve performance, it's recommended to increase the disk
speed (e.g. by leveraging a RAM-backed filesystem), or increase the available
CPU cores and add more parallelisation. This can help because AlphaFold 3 runs
genetic search against 4 databases in parallel, so the optimal number of cores
is the number of cores used for each Jackhmmer process times 4. Also note that
for sequences with deep MSAs, Jackhmmer or Nhmmer may need a substantial amount
of RAM beyond the recommended 64 GB of RAM.

Sharded genetic databases

The run time of the genetic database search can be significantly sped up by
splitting the genetic databases if a machine with many CPU cores is used and the
databases are on very fast SSD or in a RAM-backed filesystem. With this
technique you can make Jackhmmer/Nhmmer genetic search fully utilize your
hardware and take advantage of multi-core systems.

Each genetic database with n sequences is split into s shards, each
containing roughly n / s sequences. We recommend splitting the sequences
between shards randomly to make sure each shard has similar sequence length
distribution. This could be achieved using standard tools:

1. Shuffle the sequences in the fasta. This can be done for example by running:
seqkit shuffle --two-pass <db.fasta>
2. Split the shuffled fasta in s shards. This can be done for example by
running:
seqkit split2 --by-part <s> <db.fasta>

Make sure the shards names follow this pattern:
prefix-<shard_index>-of-<total_shards>, both shard_index and total_shards
having always 5 digits, with leading zeros as needed. The
shard_index goes
from 0 to
total_shards - 1. A file "path" (spec) for a sharded file is
prefix@<total_shards>.

E.g. for a file named uniprot.fasta split into 3 shards, the names of the
shards should be:

* uniprot.fasta-00000-of-00003
*
uniprot.fasta-00001-of-00003
*
uniprot.fasta-00002-of-00003

The file spec for these files is uniprot.fasta@3.

Save the total number of sequences in the protein databases, and the total
number of nucleic bases in the RNA databases – these will be needed later as a
flag to Jackhmmer/Nhmmer to correctly scale e-values across all shards.

Save the sharded databases on a fast SSD or in a RAM-backed filesystem, then
launch AlphaFold with the sharded paths instead of normal paths and set the
Z-values.

For instance with each database sharded into 16 shards:

bash
python run_alphafold.py \
--small_bfd_database_path="bfd-first_non_consensus_sequences.fasta@64" \
--small_bfd_z_value=65984053 \
--mgnify_database_path="mgy_clusters_2022_05.fa@512" \
--mgnify_z_value=623796864 \
--uniprot_cluster_annot_database_path="uniprot_cluster_annot_2021_04.fasta@256" \
--uniprot_cluster_annot_z_value=225619586 \
--uniref90_database_path="uniref90_2022_05.fasta@128" \
--uniref90_z_value=153742194 \
--ntrna_database_path="nt_rna_2023_02_23_clust_seq_id_90_cov_80_rep_seq.fasta@256" \
--ntrna_z_value=76752.808514 \
--rfam_database_path="rfam_14_9_clust_seq_id_90_cov_80_rep_seq.fasta@16" \
--rfam_z_value=138.115553 \
--rna_central_database_path="rnacentral_active_seq_id_90_cov_80_linclust.fasta@64" \
--rna_central_z_value=13271.415730
--jackhmmer_n_cpu=2 \
--jackhmmer_max_parallel_shards=16 \
--nhmmer_n_cpu=2 \
--nhmmer_max_parallel_shards=16

This run will utilize (2 CPUs) × (16 max parallel shards) × (4 protein dbs
searched in parallel) = 128 cores for each protein chain, and (2 CPUs) × (16 max
parallel shards) × (3 RNA dbs searched in parallel) = 96 cores for each RNA
chain. Make sure to tune:

* the Jackhmmer/Nhmmer number of CPUs,
* the maximum number of shards searched in parallel,
* and the number of shards for each database

so that the memory bandwidth and CPUs on your machine are optimally utilized.
You should aim for consistent shard sizes across all databases (so e.g. if
database A is split into 16 shards and is 3× smaller than database B, database B
should be split into 3 × 16 = 48 shards).

Model Inference

Table 8 in the Supplementary Information of the
AlphaFold 3 paper provides
compile-free inference timings for AlphaFold 3 when configured to run on 16
NVIDIA A100s, with 40 GB of memory per device. In contrast, this repository
supports running AlphaFold 3 on a single NVIDIA A100 with 80 GB of memory in a
configuration optimised to maximise throughput.

We compare compile-free inference timings of these two setups in the table below
using GPU seconds (i.e. multiplying by 16 when using 16 A100s). The setup in
this repository is more efficient (by at least 2×) across all token sizes,
indicating its suitability for high-throughput applications.

Num Tokens | 1 A100 80 GB (GPU secs) | 16 A100 40 GB (GPU secs) | Improvement
:--------- | ----------------------: | -----------------------: | ----------:
1024 | 62 | 352 | 5.7×
2048 | 275 | 1136 | 4.1×
3072 | 703 | 2016 | 2.9×
4096 | 1434 | 3648 | 2.5×
5120 | 2547 | 5552 | 2.2×

Accelerator Hardware Requirements

We officially support the following configurations, and have extensively tested
them for numerical accuracy and throughput efficiency:

- 1 NVIDIA A100 (80 GB)
- 1 NVIDIA H100 (80 GB)

We compare compile-free inference timings of both configurations in the
following table:

Num Tokens | 1 A100 80 GB (seconds) | 1 H100 80 GB (seconds)
:--------- | ---------------------: | ---------------------:
1024 | 62 | 34
2048 | 275 | 144
3072 | 703 | 367
4096 | 1434 | 774
5120 | 2547 | 1416

Other Hardware Configurations

#### NVIDIA A100 (40 GB)

AlphaFold 3 can run on inputs of size up to 4,352 tokens on a single NVIDIA A100
(40 GB) with the following configuration changes:

1. Enabling unified memory.
1. Adjusting
pair_transition_shard_spec in model_config.py:

py
pair_transition_shard_spec: Sequence[_Shape2DType] = (
(2048, None),
(3072, 1024),
(None, 512),
)

The format of entries in pair_transition_shard_spec is
(num_tokens_upper_bound, shard_size). Setting shard_size=None means there is
no upper bound.

For the example above:

* (2048, None): for sequences up to 2,048 tokens, do not shard
*
(3072, 1024): for sequences up to 3,072 tokens, shard in chunks of 1,024
*
(None, 512): for all other sequences, shard in chunks of 512

While numerically accurate, this configuration will have lower throughput
compared to the set up on the NVIDIA A100 (80 GB), due to less available memory.

#### NVIDIA V100

There are known numerical issues with CUDA Capability 7.x devices. To work
around the issue, set the ENV XLA_FLAGS to include
--xla_disable_hlo_passes=custom-kernel-fusion-rewriter.

With the above flag set, AlphaFold 3 can run on inputs of size up to 1,280
tokens on a single NVIDIA V100 using unified memory.

#### NVIDIA P100

AlphaFold 3 can run on inputs of size up to 1,024 tokens on a single NVIDIA P100
with no configuration changes needed.

#### Other devices

Large-scale numerical tests have not been performed on any other devices but
they are believed to be numerically accurate.

There are known numerical issues with CUDA Capability 7.x devices. To work
around the issue, set the environment variable
XLA_FLAGS to include
--xla_disable_hlo_passes=custom-kernel-fusion-rewriter.

Compilation Buckets

To avoid excessive re-compilation of the model, AlphaFold 3 implements
compilation buckets: ranges of input sizes using a single compilation of the
model.

When featurising an input, AlphaFold 3 determines the smallest bucket the input
fits into, then adds any necessary padding. This may avoid re-compiling the
model when running inference on the input if it belongs to the same bucket as a
previously processed input.

The configuration of bucket sizes involves a trade-off: more buckets leads to
more re-compilations of the model, but less padding.

By default, the largest bucket size is 5,120 tokens. Processing inputs larger
than this maximum bucket size triggers the creation of a new bucket for exactly
that input size, and a re-compilation of the model. In this case, you may wish
to redefine the compilation bucket sizes via the
--buckets flag in
run_alphafold.py to add additional larger bucket sizes. For example, suppose
you are running inference on inputs with token sizes:
5132, 5280, 5342. Using
the default bucket sizes configured in
run_alphafold.py will trigger three
separate model compilations, one for each unique token size. If instead you pass
in the following flag to
run_alphafold.py

text
--buckets 256,512,768,1024,1280,1536,2048,2560,3072,3584,4096,4608,5120,5376

when running inference on the above three input sizes, the model will be
compiled only once for the bucket size
5376. Note: for this specific
example with input sizes
5132, 5280, 5342, passing in --buckets 5376 is
sufficient to achieve the desired compilation behaviour. The provided example
with multiple buckets illustrates a more general solution suitable for diverse
input sizes.

Additional Flags

Compilation Time Workaround with XLA Flags

To work around a known XLA issue causing the compilation time to greatly
increase, the following environment variable must be set (it is set by default
in the provided
Dockerfile).

sh
ENV XLA_FLAGS="--xla_gpu_enable_triton_gemm=false"

CUDA Capability 7.x GPUs

For all CUDA Capability 7.x GPUs (e.g. V100) the environment variable
XLA_FLAGS must be changed to include
--xla_disable_hlo_passes=custom-kernel-fusion-rewriter. Disabling the Tritron
GEMM kernels is not necessary as they are not supported for such GPUs.

sh
ENV XLA_FLAGS="--xla_disable_hlo_passes=custom-kernel-fusion-rewriter"

GPU Memory

The following environment variables (set by default in the Dockerfile) enable
folding a single input of size up to 5,120 tokens on a single A100 (80 GB) or a
single H100 (80 GB):

sh
ENV XLA_PYTHON_CLIENT_PREALLOCATE=true
ENV XLA_CLIENT_MEM_FRACTION=0.95

#### Unified Memory

If you would like to run AlphaFold 3 on inputs larger than 5,120 tokens, or on a
GPU with less memory (an A100 with 40 GB of memory, for instance), we recommend
enabling unified memory. Enabling unified memory allows the program to spill GPU
memory to host memory if there isn't enough space. This prevents an OOM, at the
cost of making the program slower by accessing host memory instead of device
memory. To learn more, check out the
NVIDIA blog post.

You can enable unified memory by setting the following environment variables in
your
Dockerfile:

sh
ENV XLA_PYTHON_CLIENT_PREALLOCATE=false
ENV TF_FORCE_UNIFIED_MEMORY=true
ENV XLA_CLIENT_MEM_FRACTION=3.2

JAX Persistent Compilation Cache

You may also want to make use of the JAX persistent compilation cache, to avoid
unnecessary recompilation of the model between runs. You can enable the
compilation cache with the
--jax_compilation_cache_dir <YOUR_DIRECTORY> flag
in
run_alphafold.py.

More detailed instructions are available in the
JAX documentation,
and more specifically the instructions for use on
Google Cloud.
In particular, note that if you would like to make use of a non-local
filesystem, such as Google Cloud Storage, you will need to install
etils` (this is not included by default in
the AlphaFold 3 Docker container).

---